PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna04423.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 394aa    MW: 43127 Da    PI: 6.7564
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna04423.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-173683148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l+ +++++G g+W++ + + g+ R++k+c++rw +yl
  mrna04423.1-v1.0-hybrid 36 KGPWTPEEDQKLLAYIEEHGHGSWRALPIKAGLQRCGKSCRLRWTNYL 83
                             79********************************************97 PP

2Myb_DNA-binding52.88.9e-1789134148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  mrna04423.1-v1.0-hybrid  89 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 134
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-252786IPR009057Homeodomain-like
PROSITE profilePS5129417.743183IPR017930Myb domain
SuperFamilySSF466892.21E-3033130IPR009057Homeodomain-like
SMARTSM007178.2E-143585IPR001005SANT/Myb domain
PfamPF002493.8E-163683IPR001005SANT/Myb domain
CDDcd001671.87E-113883No hitNo description
PROSITE profilePS5129425.89184138IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2687138IPR009057Homeodomain-like
SMARTSM007171.2E-1688136IPR001005SANT/Myb domain
PfamPF002494.7E-1689134IPR001005SANT/Myb domain
CDDcd001677.59E-1291134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MRSEALVQRL PCRLTTSLAV VEMGRSPCCD KVGLKKGPWT PEEDQKLLAY IEEHGHGSWR  60
ALPIKAGLQR CGKSCRLRWT NYLRPDIKRG KFSLQEEQTI IQLHALLGNR WSAIATHLPK  120
RTDNEIKNYW NTHLKKRLAK MGIDPVTHKP KNDALLSAHD GQSKNAANLS HMAQWESARL  180
EAEARLVRES KLRSHNSLIN QLAAAAAAST SSSSAHQLLL MKGQSLDSPT STLTTYNSEN  240
VAQGIMPSSS MIEFVGCSGA SSGDHHDQTA AINAKEEGDV QVQDWKLGFG NMPSSSTHFG  300
LHDNVAWTSS NEQVHHDRGI GGVDEIADQE GFTNLLLNNS VDRDQSMSDG GAGCDSENGG  360
SAGSDYYEDN KNYWNSILNL VNSSPSHDDS PIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26341385108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285410.0FR828541.1 Rosa rugosa mRNA for putative MYB transcription factor (myb8 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004304285.10.0PREDICTED: protein ODORANT1
SwissprotQ8GWP01e-69MYB39_ARATH; Transcription factor MYB39
TrEMBLM5WYQ51e-160M5WYQ5_PRUPE; Uncharacterized protein
STRINGVIT_14s0108g01080.t011e-146(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-122myb domain protein 16